SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081041 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081041
Domain Number 1 Region: 468-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-83
Family Protein kinases, catalytic subunit 0.0000000000465
Further Details:      
 
Domain Number 2 Region: 255-358
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-23
Family I set domains 0.00000271
Further Details:      
 
Domain Number 3 Region: 163-249
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-20
Family I set domains 0.00000888
Further Details:      
 
Domain Number 4 Region: 39-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000126
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081041   Gene: ENSMUSG00000031565   Transcript: ENSMUST00000084027
Sequence length 822
Comment pep:known chromosome:NCBIM37:8:26629244:26686186:1 gene:ENSMUSG00000031565 transcript:ENSMUST00000084027
Sequence
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
Download sequence
Identical sequences P16092
NP_034336.2.92730 XP_006509073.1.92730 XP_006509075.1.92730 ENSMUSP00000081041 ENSMUSP00000081041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]