SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081569 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081569
Domain Number 1 Region: 830-960
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.11e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 13-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.53e-18
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 271-374
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000422
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081569   Gene: ENSMUSG00000059810   Transcript: ENSMUST00000084521
Sequence length 966
Comment pep:known chromosome:NCBIM37:4:62280554:62364052:1 gene:ENSMUSG00000059810 transcript:ENSMUST00000084521
Sequence
MNRFNGLCKVCSERRYRQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTV
LQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDGGVLRRASCKSTHDLLS
PPNKREKNCTHGAPVRPEQRHSCHLVCDSSDGLLLGGWERYTEVGKRSGQHTLPALSRTT
TPTDPNYIILAPLNPGSQLLRPVYQEDTIPEEPGTTTKGKSYTGLGKKSRLMKTVQTMKG
HSNYQDCSALRPHIPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGR
NKTSQVTLFAYSDLLLFTKEEEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAE
CLFTLEAHSQEQKKRVCWCLSENIAKQQQLAAPPTERKMFETEADEKEMPLVEGKGPGAE
EPAPSKNPSPGQELPPGQDLPPSKDPSPSQELPAGQDLPPSKDPSPSQELPAGQDLPPSK
DPSPSQELPVGQDLPPRKDSSGQEAAPGPESPSSEDIATCPKPPQSPETSTSKDSPPGQG
SSPTTELPSCQGLPAGQESTSQDPLLSQEPPVIPESSASVQKRLPSQESPSSLGSLPEKD
LAEQTISSGEPPVATGAVLPASRPNFVIPEVRLDNAYSQLDGAHGGSSGEDEDAEEGEEG
GEGEEDEEDDTSDDNYGDRSEAKRSSLIETGQGAEGGFSLRVQNSLRRRTHSEGSLLQES
RGPCFASDTTLHCSDGEGATSTWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGTDL
TECDEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQPASKTDKTTKSFKPTSEEALKWSE
SLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAI
QACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQK
KMSPPL
Download sequence
Identical sequences Q9DC04
ENSMUSP00000081569 NP_599018.3.92730 ENSMUSP00000081569 10090.ENSMUSP00000081569 ENSMUSP00000095639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]