SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081958 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081958
Domain Number 1 Region: 968-1145
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 537-653
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.84e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 286-421
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-28
Family Pleckstrin-homology domain (PH domain) 0.00098
Further Details:      
 
Domain Number 4 Region: 679-850
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-26
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 
Domain Number 5 Region: 10-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000017
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 6 Region: 1279-1434
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000129
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 7 Region: 444-538
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000277
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 8 Region: 862-993
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000185
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000081958
Domain Number - Region: 1180-1255
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00444
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081958   Gene: ENSMUSG00000032812   Transcript: ENSMUST00000084896
Sequence length 1452
Comment pep:novel chromosome:NCBIM37:7:108521507:108560402:1 gene:ENSMUSG00000032812 transcript:ENSMUST00000084896
Sequence
MAEGYDAALSVAEWLRALHLEQYTALFEQHGLVWATECQGLSDAGLLDMGMHLPGHRRRI
LAGLHRAHAPPVPLPRPAPRPVPMKRHIFRSPPVPVTPPEPPPTAGEDEGLPAAPPIPPR
RSCLPPACFTPTSTAAPDPVLPPLPAKRHLVEPSVPPVPPRTGPPYPQASLLAKEELLLP
SVSPRSQPEPAETPSTLLPAFPQGPLQPPSPPPCPPVIPPKPPRLLPEFDDSDYDDVPEE
GPGAPASVMTKEEPLPSRVPRAVRVASLLSEGEELSGDDSEDDDDHAYEGIPNGGWPTSG
LNPPLRSLIPDLPLHPMDELPGGPTPITPVIKAGWLDKNPPQGSYIYQKRWVRLDADYLR
YFDSNKDAYSKRFVPVACICRVAPIGDQKFEVITNNRTFAFRAESDVERNEWMQALQQAV
VEHRARFRLSSASVLGVRGSEQPDRAGSLELRGFKNKLYVAVTGDKVQLYKNLEEFHLGI
GITFIDMNVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVA
ERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWT
EALIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKYRRYHPLFGN
QEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPAAPTPLALAEQAGQTLQMEFLRN
NQSTEVPRLDSVKPLEKHYSVTLPTVSHSGFLYKTASAGKPLQDRRAREEFSRRWCVLSD
GVLSYYENERAVTPNGEIRASEIVCLAVSPLDTHGFEHTFEVYTEGERLYLFGLENAELA
HEWVKCIAKAFVPPLAEDLLARDFERLGRLPCKAGLSLQQAQEGWFALTGSELRAVFPEG
PWEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMAWLGVIQKAAASLGD
TLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLK
EGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVN
RATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGKVVEDLINHYVVV
FSVDEEELRKQREEVTAIVKMRVAGTASGTQHAGDFICTVYLEEKKVETEQHVKIPASMT
AEELTLEILDRRNVSIREKDYWTCFEVNEKEEAERPLHFAEKVLPIVHGLGIDSHLVVKK
YQSMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVR
SQRPWSGAPETSHRPEKEWPVKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCC
DTQMELREWFATFLSVQHDGLVWPSEPSRVSRAVPEVRMGSVSLIPLRGSENEMRRSVAA
FTADPLSLLRHV
Download sequence
Identical sequences Q4LDD4
10090.ENSMUSP00000081958 ENSMUSP00000114197 XP_006508249.1.92730 XP_006508250.1.92730 XP_006508251.1.92730 XP_011240199.1.92730 ENSMUSP00000081958 ENSMUSP00000081958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]