SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082183 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082183
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 209-256
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082183   Gene: ENSMUSG00000032578   Transcript: ENSMUST00000085102
Sequence length 257
Comment pep:known chromosome:NCBIM37:9:107198357:107204318:1 gene:ENSMUSG00000032578 transcript:ENSMUST00000085102
Sequence
MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKV
LDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
TPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMADYLRQYPFQL
Download sequence
Identical sequences Q62225
10090.ENSMUSP00000082183 ENSMUSP00000082183 ENSMUSP00000082183 ENSMUSP00000082183 NP_034025.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]