SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083155 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083155
Domain Number 1 Region: 128-282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-33
Family Dual specificity phosphatase-like 0.0000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083155   Gene: ENSMUSG00000026564   Transcript: ENSMUST00000085992
Sequence length 1138
Comment pep:known chromosome:NCBIM37:1:168028284:168058029:-1 gene:ENSMUSG00000026564 transcript:ENSMUST00000085992
Sequence
MATGGDAEEEQVVPNEEDEADVRAVQARYLRSPSPSQYSVVSEAETESIFMEPIHLSSAV
AAKQIINEELKPRGLRTDTECPGMLESAEQLLVEDLYNRVREKMDDRSLFNTPCVLDLQR
ALTQDRQEAPRNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGSEFYT
GLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYL
MIFHSMAILEALMTVRRKRAIYPNDGFLKQLRELNEKLMEEREEEDGEEESEEDAGSMLG
ARVNSLMVEEEDDATSHLSGSSLGKASQVSKPVTLIDDEEEEKKLYEEWRKGQGFPKGEA
AQGRKGRSCSMSSAQDGDDCEDEDVERIIQEWQSRNERYQAKGREQWNREEEEEEENSYS
SRRRRHTLSESSASESVSSHDIRILKQQLERSTQSRRGRYRSDSESSESTWDMWNERLVE
IEKEAARKYRSKSKREELDGDCSEAGGRVREDDEESVLSEASSFYNFCSRNKDKLTPLER
WKIKRIQFGFHKKDSEAGDGGSEHGTEEAAAGEKNLSDVNLTAYQAWKLKHQKKVGSENK
EEVVEMSKGEDTVLAKKRQRRLELLERSRQTLEESQSMGSWEADSSTASRSIPLSAFSSA
APSVSADGDTASVLSTQSHRSHASNMPATPLPNLPVGPGDTISIASIQNWIANVVNETLA
QKQNEMLLLSRPPSVASMKAAPAACGLGGDDQLSVLSTSLSGCLPPPSQGRPSSDVQSVL
SSTSSLTSRAEGSGNKVRGTSKPIYSLFADNVDLKELGRKEKEMQMELQEKMSEYKMEKL
ASDNKRSSLFKKKKAKDDEDMSVGDRDEDTDSAIGSFRYSSRSNSQKPETDASSSLAISD
HYRNGRSMGNEMDSNINTWLSGLRMEEKSPPQSDWSGSSRGRYTRSSLLRETESKSCSYK
FSKSRSQEQDTSFHEANGDTVRNTSRFSSSTTKEAREMHKFSRSTFSETSSSREESPEPY
FFRRTPEPSDGEESPEPRRPNWTRPRDWEDVEESSKSDFAEFGAKRKFTQSFMRSEEEGE
KERTENREEGRFASGRQSQYRRSTNQQEEEEMDDEAIIAAWRKRQEETRTKLQRRRED
Download sequence
Identical sequences Q148W8
NP_001028516.2.92730 NP_001153521.1.92730 ENSMUSP00000083155 NYSGXRC-8735b ENSMUSP00000083155 ENSMUSP00000083155 10090.ENSMUSP00000083155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]