SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083623 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083623
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.69e-28
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083623   Gene: ENSMUSG00000066885   Transcript: ENSMUST00000086432
Sequence length 97
Comment pep:known chromosome:NCBIM37:1:137007746:137008883:-1 gene:ENSMUSG00000066885 transcript:ENSMUST00000086432
Sequence
CEHYWPVNSTPVTHGHITTHLLAEESEDEWTRREFQLQHGAEQKQRHVKQLQFTTWPDHS
VPEAPSSLLAFVELVQEEVKATQGKGPILVHCSAGVG
Download sequence
Identical sequences ENSMUSP00000083623 ENSMUSP00000083623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]