SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000084342 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000084342
Domain Number 1 Region: 8-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-93
Family Protein kinases, catalytic subunit 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000084342   Gene: ENSMUSG00000031292   Transcript: ENSMUST00000087104
Sequence length 938
Comment pep:novel chromosome:NCBIM37:X:157222240:157432634:-1 gene:ENSMUSG00000031292 transcript:ENSMUST00000087104
Sequence
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSTKRKPYHVESSTLSNRNQSTKGAALQTHHRSNSKDIQNLSVGLPRAEEGL
PANESFLNGNLAGATLSPMHTKTYQASTQPGSSSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDTKPSEGPGTKYLKSSTRSQQNRHSFMESSQSKAGTLQPSEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQITETNTSRYFPSSCLDLNSPTSPTPTRHTDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RPSVKESSREGASSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSDSSSGTNHSKRQPGFDPWKSPENISHADQLKEKEKQGFF
RSMKKKKKKTQTVPNTDGPDLLTLQKAIHSSSTASSRPKEWRPEKLSDLQTQSQPLKSLR
KLLHLSSSTNHPASSDPRFQPLTAQQAKNSFSEIRIHPLSQATGGSSNIRQEPTPKGRPA
LQLPGSSLLRYNGWKHSRSRSSQPDEVIFLASHEKWKQ
Download sequence
Identical sequences Q3UTQ8
ENSMUSP00000084342 ENSMUSP00000084342 NP_001019795.1.92730 ENSMUSP00000084342 10090.ENSMUSP00000084342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]