SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000086114 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000086114
Domain Number 1 Region: 187-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-86
Family Protein kinases, catalytic subunit 0.00000000000296
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-41
Family Regulator of G-protein signaling, RGS 0.0000000456
Further Details:      
 
Domain Number 3 Region: 554-664
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-26
Family Pleckstrin-homology domain (PH domain) 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000086114   Gene: ENSMUSG00000024858   Transcript: ENSMUST00000088737
Sequence length 689
Comment pep:known chromosome:NCBIM37:19:4286002:4306222:-1 gene:ENSMUSG00000024858 transcript:ENSMUST00000088737
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLAC
SHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKRPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
Download sequence
Identical sequences Q3U1V3 Q99MK8
10090.ENSMUSP00000086114 ENSMUSP00000086114 ENSMUSP00000086114 ENSMUSP00000025791 NP_001277747.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]