SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087642 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087642
Domain Number 1 Region: 827-955
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-19
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 
Domain Number 2 Region: 1001-1116
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.97e-19
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 3 Region: 638-752
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000692
Family Regulator of G-protein signaling, RGS 0.0054
Further Details:      
 
Domain Number 4 Region: 372-490
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000202
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087642   Gene: ENSMUSG00000037627   Transcript: ENSMUST00000090179
Sequence length 1216
Comment pep:known chromosome:NCBIM37:15:35939245:36052087:-1 gene:ENSMUSG00000037627 transcript:ENSMUST00000090179
Sequence
ENYLATDNFLVDYFNEFLSLPTFPEAIRFNVDYGVFEVVNDAPQLLEKQLKKILQNQQPR
NPIYDVVRKGKSDSKSTQKSVPCEDEAINVNYSIMCLKREQGINWIKRERLPAFLESDCY
FEYRLAKLISQATWSSTGMNFIVGTNFTPWILRRPPAPPPPSTDEDNYMIMKKFYVSLGQ
ASYTQTKDWFTLAKESENTVTMASLPCCIPHHQTASPVIATASDTEIFDDGVHPRTIKSL
SKSSKAVSELDEEEEGSISMKDSPSQALLRVYLEKKGGKERNLTLHFSSVEEFLDAYIIF
ILREAIQHITGQSLSDTPEYINYYKVSHVIFDKVPPVPSNKAIVSPPVEMVEEISKDRLE
NVSLSSESESIGPESRADWCISHRTYDIGNRREFERFKKFLKGTLGERYWWLWMDIERLK
VLKDPERHQRHLEKMKKCYLVSSGERYLSAEILSKFKLLHGSRWTADHLKNIQAEVLKPL
LLYWAPRFCVTHSASAKNASTELKFWRLRQEKPRKDVDPFPQMATLLPLRPKSCIPQTPE
VQGEEINLFQPSKFKKLSKINAGTQQLGRSEPLNAVSSKDGGLEKGSKRLPESTTVVRLT
SFTDISECLKPQLERKYTYTEEHNVKTVSNVGALGGFDMENLLQSLYVENRAGFFFTKFC
ENSGNKLWKHSVYFWFDLQAYHQLFYQETLQPFKVCKQAQYLFATYIAPSASFDIGLHQE
GKKDIYMKIQPPFEDLFDTAEEFILLSLLEPWTQMVMSDKMAYKKVELQEETRQLDSACF
RKLHALHKETISKKAEDTTGYAMAKLSLSDVSKQTEYWLNVPEGYKHFTFTDLLNNKLEF
EHFRQFLESHSSSLDLMCWIDIEQFRRIIFKDQKQREEKSIYIKNKYLNKKYFFGPRSPA
SLHQQNQIMLLSGGWGRILHEQLDASVLVEIQKHVLNRLENVWLPLFLSSEQFASRQKIK
TQMKDIADELLLQRHDRKIGVWKARQPVESKWISSSCEIIAFRKALLNPVIARQFQRFVA
LKGDLLENGVLFWQEVQKFKDLCHSHCDESIIHKKITTIINCFINSYIPPALQIDIPVEQ
AQKILEHRKELGPYVFREAQMTIFGVLFKFWPQFCEFRKNLTDEKIMSVLERRQEHKQKR
KASDTEEDKAGKSGVKQYASTTGSLTKPVLGSESLLVLQSYGRQPTWCYSKYIEALEQER
ILLKIQEEVERKMFTG
Download sequence
Identical sequences 10090.ENSMUSP00000087642 ENSMUSP00000087642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]