SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087961 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087961
Domain Number 1 Region: 192-295
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.23e-37
Family ets domain 0.0000878
Further Details:      
 
Domain Number 2 Region: 7-116
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.19e-24
Family Pointed domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087961   Gene: ENSMUSG00000012350   Transcript: ENSMUST00000090475
Sequence length 300
Comment pep:known chromosome:NCBIM37:2:103103590:103143435:-1 gene:ENSMUSG00000012350 transcript:ENSMUST00000090475
Sequence
MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQISMTTSSHLP
VAESPDMKKEQDHPVKSHTKKHNPRGTHLWEFIRDILLSPDKNPGLIKWEDRSEGIFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Download sequence
Identical sequences O70273
ENSMUSP00000087961 ENSMUSP00000106805 ENSMUSP00000087961 ENSMUSP00000087961 10090.ENSMUSP00000087961 NP_031940.1.92730 XP_006498760.1.92730 XP_006498761.1.92730 XP_006498762.1.92730 XP_006498763.1.92730 XP_006498764.1.92730 XP_006498765.1.92730 XP_021049651.1.100879 XP_021049652.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]