SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088051 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088051
Domain Number 1 Region: 143-234
Classification Level Classification E-value
Superfamily Fibronectin type III 4.11e-23
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily Immunoglobulin 5.25e-21
Family I set domains 0.0047
Further Details:      
 
Domain Number 3 Region: 61-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000375
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088051   Gene: ENSMUSG00000068745   Transcript: ENSMUST00000090563
Sequence length 355
Comment pep:known chromosome:NCBIM37:3:108167829:108182974:1 gene:ENSMUSG00000068745 transcript:ENSMUST00000090563
Sequence
METATTLEIASCSQRQVEAAADPADAKGPRTSHQQEAGSPSLQLLPSIEEHPKIWLPRAL
KQTYIRKAGETVNLLIPIQGKPKPQTTWTHNGCALDSSRVSVRNGEHDSILFIREAQRTD
SGCYQLCVQLGGLQATATINILVIEKPGPPQSIKLVDVWGANATLEWTPPQDTGNTALLG
YTVQKADKKSGLWFTVLERYHRTSCVVSNLIVGNSYAFRVFAENQCGLSDTAPVTADLAH
IQKAATVYKAKGFAQRDLSEAPKFTQPLADCTTVTGYDTQLFCCVRASPRPKIIWLKNKM
DLQGNPKYRALSQLGICSLEIRKPSPFDGGIYTCKAINALGEASVDCRVDVKAPH
Download sequence
Identical sequences Q5FW53
10090.ENSMUSP00000088051 ENSMUSP00000088051 ENSMUSP00000088051 ENSMUSP00000088051 NP_081107.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]