SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088056 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088056
Domain Number 1 Region: 1696-1990
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000345
Further Details:      
 
Domain Number 2 Region: 37-299
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.22e-74
Family Carbonic anhydrase 0.00000881
Further Details:      
 
Domain Number 3 Region: 1994-2279
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.21e-73
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000014
Further Details:      
 
Domain Number 4 Region: 308-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000121
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088056   Gene: ENSMUSG00000068748   Transcript: ENSMUST00000090568
Sequence length 2312
Comment pep:known chromosome:NCBIM37:6:22825502:23002916:1 gene:ENSMUSG00000068748 transcript:ENSMUST00000090568
Sequence
MRILQSFLACVQLLCLCRLDWAYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPICNSPK
QSPINIDEDLTQVNVNLKKLKFQGWEKASLENTFIHNTGKTVEINLTNDYYLSGGLSEKV
FKASKITFHWGKCNVSSEGSEHSLEGQKFPLEMQVYCFDADRFSSFEEAVKGKGRLRALS
ILFEVGVEENLDYKAIIDGTESVSRFGKQAALDPFVLQNLLPNSTDKYYIYNGSLTSPPC
TDTVEWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEVVCSSEPENVQADPENYTSLLVTWERPRVVYDAMIEKFAVLYQPLAGNDQAK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAVCSNGLYGKYSDQLIVDMPTEDAELDLFPE
LIGTEEIIKEEEYGKDNEEDTGLNPGRDSVTNQIRKKEPQVSTTTHYNHMGTKYNEAKTN
RSPTRGSEFSGKSDVPNTSPNSTSQHVAEFETERGISLPSQTGTNLPPHNVEGTSASLNS
GSKTLFIFPQMNLSGTAESLNTVPITEYKEVSADVSEEENFLTDFKLDTGADDSSGSSPS
TSTVPFSSDNLSHGYITSSDMPEAITYDVLKPGSTRNAPEDSAPSGSEESLKDPSLEGSV
WFPGSTDLTTQSETGSGRESFLQVNSTDIQIDESRETTESFSPDATVSQDPSVTDMGMPH
YSTFAYLPTEVTPQAFTPSSRPLDLAPTINILHSQTTQPVYNGETPLQPSYSSEVFPLAT
PLLLDNQTLNTTPAASSSDSALHATPVSPSVGVSFESILSSYDDAPLLPFSSASFSSEMF
RHLHTVSQTLPQVTSAAERDELSLHASLLVARGDLLLEPSLVQYSDVASHQATTRAASDT
LGFGSESAVFYKTSMVSQIESPRSDVVMHAYSSGPEPSYTVEGSHHVPTVSYSSAMPLHG
SVDVSDQGSLLINPSHISMPESSFITPTASLLQPPPALSGDGEWSGASSDSELLLPDADG
LRTLNISSPVSVAEFTYTTSVFADGIKPLSKSEMMYGNETELKMSSFSDMAYPSKSTVVP
KMSDVVHKWSESLKETSVSISSMKSVFPESLVYPTTKGFEQGVSHVPEIIFPVQPTHTAS
QASGDTWLKPGLSANSEAAFSDTASREVVHPSTQPLLYEAATPFNTEALLQPSFQASDVD
TLLKTALPSVPSDPILAGTPQVEQSSSSVSHPMASESGSSESMLHFTSVPILDISPSKVH
STPLQGLTVPHSSKKFSEQGLLKSKSPQQVLPSLFSNDEFFQSAHLDVSQAYPPKGRHAF
VTPVLSIDEPQNTLINKLVYSEDIFSSTEISITDKVLTGLPTLASDVLSSTDHSVPLGSG
PISLTMVSPNRDDSVTTAKLLLPSTATSKLTQSARSDADLVGGGEDGDDYDDDDYDDIDR
GRFPVNKCMSCLPYRESREKVMNDSDTQESSLVDQSDPISPLLFENTEEENGGTGVTRVD
KSPPPSMLPQNHNDGKEDSDIQMGSAVLPHTPGSKAWAVLTSDEESGSGQGTSDSLNDNE
TSTDFSFPDVNEKDTDGVLETDDTGIAPGSPRSSTPSVTSGHSGVSNSSEAEASNSSHES
RIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDNTSPRVIS
TPPTPIFPISDDIGAIPIKHFPKHVADLHASNGFTEEFETLKEFYQEVQSCTADLGITAD
SSNHPDNKHKNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGP
LKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKSVQVLA
YYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKR
HAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYV
FIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPTGKTKLEKQFQLLSQSNILQSDYSTA
LKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLLHTI
KDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMSEEHKCLSNEE
KLIVQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHD
EHGGVTAGTFCALTTLMHQLEKENAMDVYQVAKMINLMRPGVFTDIEQYQFLYKVVLSLV
STRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences B9EKR1
NP_001074775.1.92730 10090.ENSMUSP00000088056 ENSMUSP00000088056 ENSMUSP00000088056 ENSMUSP00000088056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]