SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088334 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088334
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-78
Family Protein kinases, catalytic subunit 0.000019
Further Details:      
 
Domain Number 2 Region: 335-408
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000434
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000088334
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily Tropomyosin 0.0556
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088334   Gene: ENSMUSG00000004085   Transcript: ENSMUST00000090824
Sequence length 802
Comment pep:known chromosome:NCBIM37:2:72123694:72280667:1 gene:ENSMUSG00000004085 transcript:ENSMUST00000090824
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMEHIMTWATDVAKGMHY
LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQS
LPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH
QCWEADAKKRPSFKQIISILESMSNDTNLPDQCNSFLHNKAEWRCEIEATLERLKKLERD
LSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYFWVQQLVRKGESSVE
MSGYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYLNLFHFPPL
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEVAITYIKDVTFNT
SLPDAEILKMTKPPFVMEKWIVGIAEDQTVECTVTYENDVRTPKLTKHVHSIQWDRTKPQ
DEVKAVQLAIQTLFSSSEGNPGSRSDSSADCQWLDTLRMRQIASHTSLQRSQSNPILGSP
FFPYFANQDSYAAAVRRTQTPVKYQQITPSINPSRSSSPTQYGLSRNFSSLNLSSRDSGF
SSLNDSSSERGRYSDRSRNKYYRGSVSLNSSPKGRYGGKSQHSTPSRERYSGKFYRLPQS
ALNTHQSPDFKRSPNDHDRRVPRTIPGMPLHPETASKAGEEESRVSEGGWTKVEYRKKTH
RQLSAKTSKERTRGNYRGRRNF
Download sequence
Identical sequences Q9ESL4
ENSMUSP00000088334 NP_075544.1.92730 XP_006500060.1.92730 ENSMUSP00000088334 ENSMUSP00000088334 10090.ENSMUSP00000088334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]