SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088563 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088563
Domain Number 1 Region: 14-304
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-79
Family Ras GEF 0.0000363
Further Details:      
 
Domain Number 2 Region: 454-577
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088563   Gene: ENSMUSG00000038831   Transcript: ENSMUST00000091039
Sequence length 585
Comment pep:known chromosome:NCBIM37:2:32992493:33226998:-1 gene:ENSMUSG00000038831 transcript:ENSMUST00000091039
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTRDYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSSSARFRRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNLMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLTHTSSTAITNGLSLGSSESSEFSEEMSAGLESRGRL
YATLGPNWRVPVRNSPRTRSCVYSPTSPCTCTVGSSATVPTMEGPLRRKTLLKEGRKPAL
SSWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQL
NNPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRPQVPANLMSFE
Download sequence
Identical sequences A2AR50
10090.ENSMUSP00000088563 NP_780420.1.92730 XP_006498095.1.92730 ENSMUSP00000088563 ENSMUSP00000108789 ENSMUSP00000088563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]