SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089079 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089079
Domain Number 1 Region: 199-348
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-24
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.02e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089079   Gene: ENSMUSG00000026657   Transcript: ENSMUST00000091497
Sequence length 1031
Comment pep:known chromosome:NCBIM37:2:4073918:4534988:1 gene:ENSMUSG00000026657 transcript:ENSMUST00000091497
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDS
EVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEYYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIF
QWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQ
ESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKRLCLREAELTGKLPVEYPLDPGEEP
PIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQ
RKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLVIDDGNIASEDSSLSDALVLEDED
SQVTSTISPLQSPHKGLPPRPPSSHNRPPPPQSLEGLRQLHYHRTDYDKSPLKPKMWSES
SLDEPYEKVKKRSSHGHSSSHKRFPSTGSCTEAGVSSSLQNSPIRSLPHWNSQSSMPSTP
DLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRT
RSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGS
ASSGSMPNLAARSGAASTGGGVYLHSQSQPSSQYRIKEYPLYIEGSATPVVVRSLESDQE
GHYSVKAQFKTSNSYTAGGLFKESWRGGGDEGDAGRLTPSRSQILRTPSLGRDGAHDKGS
GRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQM
CKATSAALPQSQRSSTPSSEIGATPPSSPHHILTWQTGSYSDSCFLDSSLYPELADVQWY
GQEKAKPGTLV
Download sequence
Identical sequences 10090.ENSMUSP00000110694 ENSMUSP00000089079 XP_006497503.1.92730 XP_006497504.1.92730 XP_006497505.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]