SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089708 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089708
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.14e-81
Family STAT DNA-binding domain 0.00038
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-35
Family SH2 domain 0.00026
Further Details:      
 
Domain Number 3 Region: 114-273
Classification Level Classification E-value
Superfamily STAT 1.18e-26
Family STAT 0.0028
Further Details:      
 
Domain Number 4 Region: 1-114
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.22e-25
Family Transcription factor STAT-4 N-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089708   Gene: ENSMUSG00000002147   Transcript: ENSMUST00000092074
Sequence length 837
Comment pep:known chromosome:NCBIM37:10:127080042:127098013:1 gene:ENSMUSG00000002147 transcript:ENSMUST00000092074
Sequence
MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW
Download sequence
Identical sequences P52633
ENSMUSP00000089708 10090.ENSMUSP00000089708 NP_033310.2.92730 ENSMUSP00000089708 ENSMUSP00000089708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]