SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089805 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089805
Domain Number 1 Region: 1682-1964
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000112
Further Details:      
 
Domain Number 2 Region: 641-724
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000116
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 3 Region: 817-897
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000144
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 4 Region: 287-367
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000222
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 5 Region: 109-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000365
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 465-545
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000465
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 7 Region: 729-808
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000503
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 8 Region: 1171-1251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000103
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 9 Region: 993-1084
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000243
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 10 Region: 1353-1457
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000661
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 11 Region: 202-279
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000889
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 12 Region: 906-985
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000935
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 13 Region: 552-642
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000247
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 14 Region: 1083-1163
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000789
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 15 Region: 375-457
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000126
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 16 Region: 1260-1349
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000254
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 17 Region: 34-101
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000476
Family Fibronectin type III 0.007
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000089805
Domain Number - Region: 1449-1507,1560-1590
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00323
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089805   Gene: ENSMUSG00000020154   Transcript: ENSMUST00000092167
Sequence length 1998
Comment pep:known chromosome:NCBIM37:10:115738430:115826594:1 gene:ENSMUSG00000020154 transcript:ENSMUST00000092167
Sequence
MLRHGALTALWITLSVVQTGVAEQVKCNFTLLESRVSSLSASIQWRTFASPCNFSLIYSS
DTSGPMWCHPIRIDNFTYGCNPKDLQAGTVYNFRIVSLDGEESTLVLQTDPLPPARFEVN
REKTASTTLQVRWTPSSGKVSWYEVQLFDHNNQKIQEVQVQESTTWSQYTFLNLTEGNSY
KVAITAVSGEKRSFPVYINGSTVPSPVKDLGISPNPNSLLISWSRGSGNVEQYRLVLMDK
GAIVQDTNVDRRDTSYAFHELTPGHLYNLTIVTMASGLQNSRWKLVRTAPMEVSNLKVTN
DGRLTSLNVKWQKPPGDVDSYSITLSHQGTIKESKTLAPPVTETQFKDLVPGRLYQVTIS
CISGELSAEKSAAGRTVPEKVRNLVSYNEIWMKSFTVNWTPPAGDWEHYRIVLFNESLVL
LNTTVGKEETHYALDGLELIPGRQYEIEVIVESGNLRNSERCQGRTVPLAVLQLRVKHAN
ETSLGITWRAPLGEWEKYIISLMDRELLVIHKSLSKDAKEFTFTDLMPGRNYKATVTSMS
GDLKQSSSIKGRTVPAQVTDLHVNNQGMTSSLFTNWTKALGDVEFYQVLLIHENVVVKNE
SVSSDTSRYSFRALKPGSLYSVVVTTVSGGISSRQVVAEGRTVPSSVSGVTVNNSGRNDY
LSVSWLPAPGEVDHYVVSLSHEGKVDQFLIIAKSVSECSFSSLTPGRLYNVTVTTKSGNY
ASHSFTEERTVPDKVQGISVSNSARSDYLKVSWVHATGDFDHYEVTIKNRESFIQTKTIP
KSENECEFIELVPGRLYSVTVSTKSGQYEASEQGTGRTIPEPVKDLTLLNRSTEDLHVTW
SRANGDVDQYEVQLLFNDMKVFPHIHLVNTATEYKFTALTPGRHYKILVLTISGDVQQSA
FIEGLTVPSTVKNIHISANGATDRLMVTWSPGGGDVDSYVVSAFRQDEKVDSQTIPKHAS
EHTFHRLEAGAKYRIAIVSVSGSLRNQIDALGQTVPASVQGVVAANAYSSNSLTVSWQKA
LGVAERYDILLLNENGLLLSNVSEPATARQHKFEDLTPGKKYKMQILTVSGGLFSKESQA
EGRTVPAAVTNLRITENSSRYLSFGWTASEGELSWYNIFLYNPDRTLQERAQVDPLVQSF
SFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPAAVNHLKGSHRNTTDSLWFSWSPASG
DFDFYELILYNPNGTKKENWKEKDVTEWRFQGLVPGRKYTLYVVTHSGDLSNKVTGEGRT
APSPPSLLSFADVANTSLAITWKGPPDWTDYNDFELQWFPGDALTIFNPYSSRKSEGRIV
YGLHPGRSYQFSVKTVSGDSWKTYSKPISGSVRTKPDKIQNLHCRPQNSTAIACSWIPPD
SDFDGYSIECRKMDTQEIEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVED
STITMIDRPPQPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFAVVVREADSMD
ELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAESPDSSSKSFNIKLGAEMDSLGGKC
DPSQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSMPITTESEPLFGV
IEGVSAGLFLIGMLVALVAFFICRQKASHSRERPSARLSIRRDRPLSVHLNLGQKGNRKT
SCPIKINQFEGHFMKLQADSNYLLSKEYEDLKDVGRSQSCDIALLPENRGKNRYNNILPY
DASRVKLCNVDDDPCSDYINASYIPGNNFRREYIATQGPLPGTKDDFWKMAWEQNVHNIV
MVTQCVEKGRVKCDHYWPADQDPLYYGDLILQMVSESVLPEWTIREFKICSEEQLDAHRL
IRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFVALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAKKLRNEQENPLFP
IYENVNPEYHRDAIYSRH
Download sequence
Identical sequences B2RU80
10090.ENSMUSP00000089805 ENSMUSP00000089805 NP_084204.2.92730 ENSMUSP00000089805 ENSMUSP00000089805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]