SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090565 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090565
Domain Number 1 Region: 24-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-78
Family Protein kinases, catalytic subunit 0.00000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090565   Gene: ENSMUSG00000061288   Transcript: ENSMUST00000092889
Sequence length 898
Comment pep:known chromosome:NCBIM37:5:117583604:117725228:1 gene:ENSMUSG00000061288 transcript:ENSMUST00000092889
Sequence
MRKGALKDPEIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGK
QTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQ
EVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVG
TPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPT
LQSREWTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAVREL
DNLQYRKMKKILFQETRNGPLNESQEEEEDGEQGSNLNREVDSLGSIHSIPSTSVSTGSR
SSSVNSMQEVMDESSSELVMMQEDEGTANSSASTVHKKDHVFVRDEAGHGDPRPEPRPTQ
SVQSRALHYRNRERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALEN
KLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQ
QKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHL
LTQQRLYYDRNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELE
YRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIK
KQFQDTCKVQTKQYKALKNHQLEVTPKNEHKAILKTLKDEQTRKLAILAEQYEQSINEMM
ASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRA
HLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLVTLDFPKEDYR
Download sequence
Identical sequences Q8BYC6
ENSMUSP00000090565 ENSMUSP00000107609 ENSMUSP00000136750 NP_001074777.1.92730 NP_001186614.1.92730 NP_899129.2.92730 XP_006530448.1.92730 XP_011246521.1.92730 XP_011246522.1.92730 ENSMUSP00000090565 ENSMUSP00000090565 10090.ENSMUSP00000090565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]