SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090737 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090737
Domain Number 1 Region: 127-187
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000583
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090737   Gene: ENSMUSG00000001482   Transcript: ENSMUST00000093049
Sequence length 483
Comment pep:novel chromosome:NCBIM37:8:125966886:125984415:1 gene:ENSMUSG00000001482 transcript:ENSMUST00000093049
Sequence
MEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSEDTLPELPAGEPEFHYSERMMDL
GLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQEL
KDPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLN
LISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYTGQYY
CSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEEL
VEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRLSC
SLTEIHTLFAKHIKLDCERCQAKGFVCELCKEGDVLFPFDSHTSVCNDCSAVFHRWVRPV
AHSRLGVEAPPHFLSRMPSLVLGCSWSGGTWHCCPERGDRHWAFAVFLSKSFAGVRPWCL
CLN
Download sequence
Identical sequences ENSMUSP00000090737 10090.ENSMUSP00000090737 ENSMUSP00000090737 ENSMUSP00000090737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]