SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091442 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091442
Domain Number 1 Region: 434-618
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-35
Family SPRY domain 0.0036
Further Details:      
 
Domain Number 2 Region: 64-140
Classification Level Classification E-value
Superfamily RING/U-box 9.09e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 200-264
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000611
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091442   Gene: ENSMUSG00000070332   Transcript: ENSMUST00000093914
Sequence length 624
Comment pep:known chromosome:NCBIM37:11:115301859:115309584:1 gene:ENSMUSG00000070332 transcript:ENSMUST00000093914
Sequence
MKQRPQRKERRRQSSVHRATKYLALMDMQKISRSAQDKPPSQLSSQPSRTPLHLLMGSNS
SQHMLEDQVLCPICLEVFCNPVTTACGHNFCMTCLQNFWDHQAAIGETYYCPQCREAFSS
RPRLCKNVILGEMVACFTQAKSQTSGSLWGLAGPTDVPCDFCSPQKLRAAKSCLQCVASL
CEKHLRSHFEDQLFQDHQLLDPVWDLTNRLCRKHRKLRQLYCRTEGSCVCGACLLEEHKN
HDTTPLEDERARKEVEVRKIQANVENQMLIIASDSQKHQGRVSFLSKLIQTMRDEVDTCF
SEILHEIKQLQMKVLDFVEKEEAAALGKLGNSIQQSHNRLLKLEGDSVWLHSLLANRSDE
QFLQEFPKLKHFPACVEPLLGTNCEETQSFLQLPETLSQLRIRLMDIGLSFINQLLLKGI
RMSSYEVLPGTVERKTLLQNYCNLNFDPCTASEELFLFKETHSVLNLGILLEPSTTNSPL
PGFKQWPQVLCCPGLSEGCHYWEAEVSNSWMCLGVTYRRSPPLSGRPRRNIVYLLGRNPY
SWCLEWDSLKFSVWHNNTQTVLHGSYHHTLGVALDFRTGCLSFYSVAGDVNLLYRFLTSF
LEPLYPAVMVSSGASLTLKQYPEA
Download sequence
Identical sequences Q3V061
NP_001028947.1.92730 ENSMUSP00000091442 ENSMUSP00000091442 ENSMUSP00000091442 10090.ENSMUSP00000091442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]