SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093603 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093603
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-41
Family Dual specificity phosphatase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093603   Gene: ENSMUSG00000069255   Transcript: ENSMUST00000095914
Sequence length 205
Comment pep:known chromosome:NCBIM37:13:30751979:30800770:1 gene:ENSMUSG00000069255 transcript:ENSMUST00000095914
Sequence
MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARPMLEGVKYLCIPAADTPS
QNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPLRDAEEAKNILGKYKEQGRMEP
RPSSRRWSSFSTLPPLTYNNYTTET
Download sequence
Identical sequences NP_001033044.1.92730 ENSMUSP00000105939 ENSMUSP00000093603 10090.ENSMUSP00000093603 ENSMUSP00000093603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]