SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093762 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093762
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-45
Family Calponin-homology domain, CH-domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093762   Gene: ENSMUSG00000022658   Transcript: ENSMUST00000096057
Sequence length 199
Comment pep:known chromosome:NCBIM37:16:45711343:45724721:-1 gene:ENSMUSG00000022658 transcript:ENSMUST00000096057
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences Q9R1Q8
10090.ENSMUSP00000093762 NP_062728.1.92730 XP_003497895.1.69978 XP_004436645.1.5094 XP_004436646.1.5094 XP_006975849.1.50099 XP_007619515.1.28591 XP_013207207.1.66349 XP_021519744.1.76796 ENSMUSP00000093762 ENSMUSP00000093762 ENSMUSP00000093762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]