SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095691 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095691
Domain Number 1 Region: 9-37,65-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-55
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 284-411
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.51e-29
Family Ankyrin repeat 0.00061
Further Details:      
 
Domain Number 3 Region: 770-833
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000135
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095691   Gene: ENSMUSG00000066191   Transcript: ENSMUST00000098085
Sequence length 883
Comment pep:known chromosome:NCBIM37:4:47028561:47070178:-1 gene:ENSMUSG00000066191 transcript:ENSMUST00000098085
Sequence
MGEGALAPGLQLLLRACEQGDTDTARRLLEPGADPVAGPEAGAEPAGPEAVRAAEAGAPV
PVDCSDEAGNSALQLAAAGGHEPLVRFLLRRGASVNSRNHYGWSALMQAARCGHVSVAHL
LLDHGADVNAQNRLGASVLTVASRGGHLGVVKLLLEAGAIVDHHTPSGESPATGGSGDEL
LGITALMAAVQHGHEAVVRLLMEWGADPNHTARTVGWSPLMLAALLGKLNVAQQLVEKGA
NPDHLSVLEKTAFEVALDRKYRDLAEYLDPLTTVRPKTDEEKRRPDIFYALKMGNFQLVK
EIADEDPNHVNLVNGDGATPLMLAAVTGHLPLVQLLVEKHADMDKQDSVHGWTALMQATY
HGNKEIVKYLLNQGADVALRAKNGYTAFDLVMLLNDPDTELVRLLASVCMQVNKDRGRPS
HRPPLPHSKARQPWSIPVLPDDKGGLKSWWSRMSNRFRKLKLMQTLPRGLAANQPLPFSD
EPELALDSTMRAPPQDRTSHLGPPEAAHATKDSGPGNPRREKGDVLLTTMLRNGAPFPRL
PSDKLKAVIPPFLPPSSFELWSSDRSHTCHNGKADPTKTALPPRASRAHPVGCVGTDGAT
SRPVKFPSISRSPASPASSGSFNHSPHSSGGASGIGGMSRLGGELHSRSGGSVDSVLSQI
AAQRKKAAGLCEQKPRQQSSPVGPATSSSPPELPASLPSSGSGSSSGPSSSKKLDPSKRP
PSGTSATSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGIL
KKLSLEKYQPIFEEQEVDMEAFLTLTDGDLQELGIKTDGSRQQILAAISELNAGKGRERQ
ILQETIHNFHSSFESSASNTRAPGNGPSMAGWTRPEETVSSRR
Download sequence
Identical sequences Q6GQX6
XP_006538395.1.92730 10090.ENSMUSP00000095691 ENSMUSP00000095691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]