SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095738 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095738
Domain Number 1 Region: 545-618
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.7e-16
Family SAM (sterile alpha motif) domain 0.032
Further Details:      
 
Domain Number 2 Region: 626-696
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000472
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 3 Region: 703-779
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000629
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000095738
Domain Number - Region: 107-161
Classification Level Classification E-value
Superfamily MPN010-like 0.00275
Family MPN010-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095738   Gene: ENSMUSG00000036528   Transcript: ENSMUST00000098134
Sequence length 904
Comment pep:known chromosome:NCBIM37:7:114750358:114892096:1 gene:ENSMUSG00000036528 transcript:ENSMUST00000098134
Sequence
MTSDASHMLEAALEQMDGIIAGTKTAADFSDGTCEPGLSPPSTCLNSMPVLHLIEDLRLA
LEMLALPQEREALLSQVPGPTATYIKEWFEDSLSQVNHHGAASNETYQERLARLEGDKES
LILQVSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTE
VSELKLKLVGMEKEQKEQEEKQRKAEELLQELKHLKIKVEELENERNQYEWELKATKAEV
AQLQEQVALKDAEIERLHSQLSRSAALHSDHAERDQEIHRLKMGMETLLVANEDKDRRIE
ELTGLLNKYLRVKEIVMATQGPSERTLSINEDEIEGSFRKWNTTNKSPEEVPKQEISPRC
SSPTPGPPPLPQKSLESRAQKKLSCSLEDLRRESGDKCVDGNQLSPVGEPKDSSFLAEQK
YPTLPGKLSGATPNGEAAKSPPTASLQPDSSGSSQPKLRDTEGGWEDIVSSASSGTESSP
QSPVTPDGKRSPKGIKKFWGKIRRTQSGNFNTDAPGMAEFRRGGLRATAGPRLSRTRDTK
GQKCDANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKH
PLHRKKLVLAVKAINAKQEETSALLDHIWVTRWLDDIGLPQYKDQFHESRVDGRMLQYLT
VNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADESNLSPSEVVQWSNHRVME
WLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALI
GPEAEQEKRDKMASPAYTPLTTTAKVRPRKLGFSHFGNMRKKKFDESTDYICPMEPGDAV
SDSHRVYGVYRGLSPLDNHELDGLDQMAPSEGTVTQIGLLSQDIHRLTTLLSQDQLLNDP
PGCP
Download sequence
Identical sequences NP_001157029.1.92730 ENSMUSP00000042574 10090.ENSMUSP00000095738 ENSMUSP00000095738 ENSMUSP00000095738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]