SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096245 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096245
Domain Number 1 Region: 144-675,835-1029
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.79e-258
Family Motor proteins 0.00000000258
Further Details:      
 
Domain Number 2 Region: 1682-1871
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000964
Further Details:      
 
Domain Number 3 Region: 1612-1671
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000124
Family Ras-binding domain, RBD 0.027
Further Details:      
 
Domain Number 5 Region: 1030-1078
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000012
Family Motor proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096245   Gene: ENSMUSG00000004677   Transcript: ENSMUST00000098648
Sequence length 2144
Comment pep:known chromosome:NCBIM37:8:73796613:73884611:1 gene:ENSMUSG00000004677 transcript:ENSMUST00000098648
Sequence
MSAHEAGSSGRRQQATYHLHIYPQLSSAGSQTSCRVTATKDSTTSDVIQDVVASLHLDGS
KHYVLVEVKESGGEEWVLDASDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGSIQY
LPIQLLAQPTAACRLVERGLLPRPQADFDDLCNLPELTEANLLQNLKLRFMQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYAMLRKHVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYLENGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERLEFQLKQPQD
YFYLNQHNLNIEDGEDLKHDFERLQQAMEMVGFLPATKKQIFSVLSAILYLGNVTYKKRA
TGRDEGLEVGPPEVLDTLSQLLKVKRETLVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDMEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFTQHIFKLEQEEYQGEGISWHNIDYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSHTLLAKFKQQHEDNKYFLGTPVLEPAFIIQHFAGRVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRQLIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGISSPAT
RSHMEELPRGASTPSEKLYRCTGLDFSFERSEELDVNAFEDIMAFYESRNDLHNQIIKSL
KGLPWQGEDPRRLLQSLSLFQKPRTSFLKSKGIKQKQIIPKNLLDSKSLRLIISMTLHDR
TTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVL
QQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLLPKDVQPCREAIAALLEKLQVDRQN
YQIGKTKVFLKETERQTLQEKLHGEVLRRILQLQSWFRMVLERKHFVQMKHAALTIQACW
RSYRVRRALERTQAAVYLQAAWRGYLQRQAYHHQRHSIIRLQSLCRGHLQRRSFSQMVSE
KQKAEQAREAAGGKLSEGEPGPVAAGEQLSEHPVEDPESLGVEAETWMNKSPDGMSPKKE
TPSPEMETAAQKTVPAESHEKVSSSREKRESRRQRGLEHVERQNKHIQSCREESSTHREP
SRRASLEIGESFPEGTKGPREDGLEAWTETTAPSSSKQAQVVGDPPGSPSPVQRPTTLAL
DSRVSPVLPSSSLESPKDKDKDESSTKAQDKPESPSGSTQIQRYQHPDTERLATAVEIWR
GKKLASAVLSQSLDLSEKHRATGAALTPTEERRISFSTSDVSKLSPVKTSAEIDGDFSSK
KPSIHKKKSGDPSAGPDAGLSPGSQGDSKSAFKRLFLHKAKDKKPSLEGVEETESNGGQA
AQETPARKTLDVPSSQQHRHTTGEKPLKGKKNRNRKVGQITVSEKWRESVFRKITNANEL
KFLDEFLLNKVNDLRSQKTPIESLFIEATERFRSNIKTMYSVPNGKIHVGYKDLMENYQI
VVSNLAAERGEKDTNLVLNVFQSLLDEFTRSYNKTDFERAKSKAQKKKRKQERAVQEHNG
HVFASYQVNIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSYCSYTGRRKSELG
AEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQALQT
DPAAVKLEDFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLSAIYAVLD
HLPEANHTSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLK
ITTCVEMLIKEQMRKYKMKMEEINHLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVR
IKSPRTPVVQDLELGALPEEAAGGDEDREKEILMERIQSIKEEKEDITYRLPELDPRGSD
EENLDSETSASTESLLEERGVRGAVEGPPAPALPCPISPTLSPLPEAAAPPRGRPTSFVT
VRVKTPRRTPIMPMANIKLPPGLPLHLTSWAPALQEAVVPVKRREPPARRQDQVHSVYIA
PGADLPSQSTLIALDHDTILPGTKRRYSDPPTYCLPPSSGQANG
Download sequence
Identical sequences ENSMUSP00000096245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]