SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096280 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096280
Domain Number 1 Region: 42-231
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.35e-67
Family Regulator of G-protein signaling, RGS 0.0000000134
Further Details:      
 
Domain Number 2 Region: 454-681
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-60
Family DBL homology domain (DH-domain) 0.000000577
Further Details:      
 
Domain Number 3 Region: 683-817
Classification Level Classification E-value
Superfamily PH domain-like 2.75e-39
Family Pleckstrin-homology domain (PH domain) 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096280   Gene: ENSMUSG00000040940   Transcript: ENSMUST00000098683
Sequence length 979
Comment pep:known chromosome:NCBIM37:7:25688070:25711608:1 gene:ENSMUSG00000040940 transcript:ENSMUST00000098683
Sequence
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADEKPGPADRKG
GLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLAP
PESTEDNGETERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGS
ATAVLGPTRRATPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKRR
QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQE
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDK
AIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPSPSSIRE
PLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTE
EDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRLRPLLSQLG
GTLSPNLAAPERSAQTGLS
Download sequence
Identical sequences ENSMUSP00000113366 ENSMUSP00000096280 ENSMUSP00000096280 10090.ENSMUSP00000096280 NP_001123622.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]