SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096567 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096567
Domain Number 1 Region: 173-216
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000663
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096567   Gene: ENSMUSG00000038605   Transcript: ENSMUST00000098967
Sequence length 234
Comment pep:known chromosome:NCBIM37:2:181331484:181333903:-1 gene:ENSMUSG00000038605 transcript:ENSMUST00000098967
Sequence
CAQGWAAGALPRRLPGRGDRLGLGRLRRVGTRCALPTGHTGCLVLREGRVPEPHIRGLHV
HRAAVQAEPPASSRRGCASGLRGASGCGRFCQTLLEHTVSAENIPCHLPRTPGTSLTWHD
SRSQRASSSRPIKLLQQPGSEIPQARLYSDHYGLYHTPFTGWPDGQWSCGANKTFAWLKK
HCPHNYLVYVEAFSQHAITGRALLRLNADKLQRMGLTQESEAGGAAAGTPPAGS
Download sequence
Identical sequences ENSMUSP00000096567 10090.ENSMUSP00000096567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]