SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096880 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096880
Domain Number 1 Region: 362-449
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000171
Family PDZ domain 0.04
Further Details:      
 
Domain Number 2 Region: 831-880
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096880   Gene: ENSMUSG00000074746   Transcript: ENSMUST00000099274
Sequence length 1147
Comment pep:known chromosome:NCBIM37:19:59370574:59420270:-1 gene:ENSMUSG00000074746 transcript:ENSMUST00000099274
Sequence
MGLLLLILASAVLGSFLTLLAQFLLLYRRQPEPRADEAARAGDGFRYLKPVPGLPLREYL
YGGGAEELAACSSEAGASSTPTPDSPAPPTLETCYFLNATILFLFRELRDTALARRWVTK
KIKVEFEELLQTKTAGRLLEGLSLRDVFLGDTVPFIKTIRLVRPVVASGTGEPDDPDGDA
LPATCPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRFVLTRVPFTHW
FFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPSYKIRFKPFFPYQAL
QGFEEDEELIHIQQWALTEGRLKVTLLECSRLFIFGSYDRETNVHCTLELSSGVWEEKQR
SSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAMADLQRGDRLIAIGG
VKITSTLQVLKLIKQAGDRVLVYYQRPAGQSSQDSLGQLEESFLSSSCQAAYEEDAAGLS
ADTENRDLDSEFEDLASDVRVQTELKEETQPLSHSPKRTPTTLSIKPLGAISPVLNRKLI
SGIHPPPQKLPSKEGNKPSTLKTSETTEAAQVSKPQGPTFKPPVPPRPQGRVPLPPTDTS
AQADPEAPEKPDKVLLPPPPADKPAEKQVKSVDQGEDVAAGKQSSAKQEGVKDLPSESSA
PTKDSSDDPQMWESSEVLYRNKVGKWSRTRASCVFDIEACHRYLNIALWCRDPFKLGGLI
CLGHVSLKLEEVALGCLATSNMEYLTKFRLEPPTPKAMVTRTALRNLSMQKGFNDKFCFG
DITIHFKYLKEGEPDHHIVPNVEKEKELHLVEEVSTLPKEEHFVGQMSLSENKHSFQDTQ
FQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETPLCGATERRIDRTLKNLRL
EGQDPLLGLPPRVEIEANKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPS
PKHTPNTSDNEGSDTEVCGSNSPSKRGNSAGIKLMRKEGGLDDSVFIAVKEIGRDLYRGL
PTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETNDTRKKSVLSAALAKSGERLQAL
TLLMIHYRAGIEDIETLENLSLDQHSKKMNKYADDTEEDLDSEISQLIDSQPFSNISDDL
FGPSESV
Download sequence
Identical sequences B9EJ80
10090.ENSMUSP00000096880 NP_001028394.2.92730 ENSMUSP00000096880 ENSMUSP00000096880 ENSMUSP00000096880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]