SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096968 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096968
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.62e-60
Family Ankyrin repeat 0.0000487
Further Details:      
 
Domain Number 2 Region: 1024-1189
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-47
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 3 Region: 806-876
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.62e-18
Family SAM (sterile alpha motif) domain 0.0062
Further Details:      
 
Domain Number 4 Region: 879-942
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000139
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096968   Gene: ENSMUSG00000058589   Transcript: ENSMUST00000099368
Sequence length 1259
Comment pep:known chromosome:NCBIM37:10:89336417:90432659:1 gene:ENSMUSG00000058589 transcript:ENSMUST00000099368
Sequence
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGAGRSAAVLEEHAQ
EDTAQETHLSSPAESPQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEDEEEDPNSCGPTGLWEALTPCNGCRNLGFP
MLAQESYPKKRNFPMEMEPSASLDTFPSENENFLCELVDTAVTKKPCSLEIARAPSPRTD
NASEVAITAPGTSHHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFQR
MNHNQEYFEISTSTGCTSFTSSPAASPPTSSVETTEVKNEGAEHADDLSQQEDDEPPKEY
DAGQFAGLLHGSSPACESPENPFHLYGKRNTCEDGPDEASLANSPLPFKQTPIENNPEPS
VKKVKPKVVSRTIFHKRNHQLENHTIVGTRMSRSGSRNGDQWGVNPGGFVERACTLGRIR
SLPKALIDMHLSKNVSKSDSDLIAYPSKDKARVNWSKSSTAERSSKDNSERTPSFTSEWE
EIDKIMNSIDVGINSELEGMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDSVQF
MGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDY
TKAFLINGYTSMDLLKKIWELELINVLKISLIGHRKRILASLGDRLHDDPPQKPPRSITL
REPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMA
QTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTEST
QDACAKMRANCRKSTEQMKKVPTIILSVSYKGVKFIDAANKNIIAEHEIRNISCAAQDPE
DLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTL
PESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences Q8BIZ1
ENSMUSP00000096968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]