SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097114 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097114
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.73e-20
Family SAM (sterile alpha motif) domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097114   Gene: ENSMUSG00000040451   Transcript: ENSMUST00000099514
Sequence length 419
Comment pep:known chromosome:NCBIM37:19:32197217:32463002:-1 gene:ENSMUSG00000040451 transcript:ENSMUST00000099514
Sequence
MLSARTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLYRVSS
DNGQRLLDMIETLKMEHHMEAHKNGHANGHLSIGVDIPNPDGSFSIKTKPNGMPNGFRKE
MIKIPMPEPERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFF
DHFNRVQWAFSICEINGMILVGLWLFQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT
LPVPGMHFNCSPKLFGDWEAQVRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYL
FIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ
VLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT
Download sequence
Identical sequences Q8VCQ6
NP_001161997.1.92730 NP_001161998.1.92730 NP_659041.3.92730 XP_006526881.1.92730 XP_006526882.1.92730 XP_006526883.1.92730 XP_011245503.1.92730 XP_011245504.1.92730 XP_011245505.1.92730 ENSMUSP00000097114 ENSMUSP00000097114 10090.ENSMUSP00000123395 ENSMUSP00000097114 ENSMUSP00000117336 ENSMUSP00000123395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]