SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097773 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097773
Domain Number 1 Region: 301-386
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000013
Family SAM (sterile alpha motif) domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097773   Gene: ENSMUSG00000009733   Transcript: ENSMUST00000100199
Sequence length 505
Comment pep:known chromosome:NCBIM37:15:100340007:100382439:-1 gene:ENSMUSG00000009733 transcript:ENSMUST00000100199
Sequence
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
ENEILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPELNGKLVKSIF
RVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGVIDPRANPTQLNTVEFLWDPS
KRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFKP
KGADRKQKIDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDS
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDEVVLSCLI
LPGTELWSSGRTAGTLNHCLALPFL
Download sequence
Identical sequences 10090.ENSMUSP00000097773 ENSMUSP00000097773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]