SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097874 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097874
Domain Number 1 Region: 322-639
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.36e-87
Family Protein kinases, catalytic subunit 0.0000000328
Further Details:      
 
Domain Number 2 Region: 168-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.99e-37
Family Synaptotagmin-like (S variant) 0.00000898
Further Details:      
 
Domain Number 3 Region: 25-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 96-153
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097874   Gene: ENSMUSG00000078816   Transcript: ENSMUST00000100301
Sequence length 697
Comment pep:known chromosome:NCBIM37:7:3303640:3330714:1 gene:ENSMUSG00000078816 transcript:ENSMUST00000100301
Sequence
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVQMEPSNNPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Download sequence
Identical sequences ENSMUSP00000097874 10090.ENSMUSP00000097874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]