SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099071 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099071
Domain Number 1 Region: 368-690
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.5e-55
Family Diacylglycerol kinase-like 0.012
Further Details:      
 
Domain Number 2 Region: 932-1056
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-18
Family Ankyrin repeat 0.00099
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000099071
Domain Number - Region: 164-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00802
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099071   Gene: ENSMUSG00000038665   Transcript: ENSMUST00000101532
Sequence length 1071
Comment pep:novel chromosome:NCBIM37:6:36796022:37249974:-1 gene:ENSMUSG00000038665 transcript:ENSMUST00000101532
Sequence
MDAAGRGCHLLPLPAARGPARAPAASSALSPTGLCSGTTSASFAAAGAVAMNPSSSAGEE
RGATGGSSSSGSGAGSCCLGAEGGADPRGAGAAAAAALEEPAAAGQKEKEEALEEKLRDL
TFRKQVSYRKAISRTGLQHLAPAHPLGLPVANGPAKEPRATLDWSENAVNGEHLWLETNV
SGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR
ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHI
EEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQETKGRPFV
IKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEMYRKVP
NLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKI
LCQVEDGTIVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHE
SREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQDLKFQCI
VFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCR
EVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDIHQVQAADL
RRVSAPPGSFTIPQSVPDRLRIRVNKISLQDYEGLHYDKDKLREASIPLGILVVRGDCDL
ETCRMYIDRLQEDLQSVSSGSQRVHYQDQETSFPRALSAQRLSPRWCFLDATSADRFYRI
DRSQEHLHFVMEISHDEIFILDPDMVVSQQAGTPPGMPDLVVEQASGLSDWWNPALRKRM
LSDSGMITPHYEDSDLKDFSHSRVLQSPVSSEDHAILQAVLTGDLMKLMESYKNGGSLLI
QGPGHCSLLHYAAKTGNGDIVKYILDHGPAELLDMADSETGETALHKAACQRNRAVCQLL
VDAGASLRQTDSKGKTPQERAQQAGDPDLAAYLESRQNYKIIGHEDLETAV
Download sequence
Identical sequences D3YWQ0
ENSMUSP00000099071 NP_001074675.1.92730 10090.ENSMUSP00000099071 ENSMUSP00000047858 ENSMUSP00000099071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]