SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099404 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099404
Domain Number 1 Region: 321-486,892-1071
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.05e-124
Family Mammalian PLC 0.00000668
Further Details:      
 
Domain Number 2 Region: 643-757
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 545-660
Classification Level Classification E-value
Superfamily SH2 domain 7e-27
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1089-1211
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-25
Family PLC-like (P variant) 0.0024
Further Details:      
 
Domain Number 5 Region: 790-849
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-19
Family SH3-domain 0.00003
Further Details:      
 
Domain Number 6 Region: 26-141
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 154-314
Classification Level Classification E-value
Superfamily EF-hand 0.00000173
Family Calmodulin-like 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000099404
Domain Number - Region: 476-522
Classification Level Classification E-value
Superfamily PH domain-like 0.000225
Family Pleckstrin-homology domain (PH domain) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099404   Gene: ENSMUSG00000016933   Transcript: ENSMUST00000103115
Sequence length 1302
Comment pep:known chromosome:NCBIM37:2:160557046:160601496:1 gene:ENSMUSG00000016933 transcript:ENSMUST00000103115
Sequence
MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNALRT
GERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLRRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASS
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAVLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGISLRERASDASSQLFHVRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERSTSDGPSSATNLIEDPLHDKLWKCSL
Download sequence
Identical sequences Q62077
ENSMUSP00000099404 ENSMUSP00000099404 NP_067255.2.92730 10090.ENSMUSP00000099404 ENSMUSP00000099404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]