SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099908 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099908
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.73e-36
Family Ubiquitin-related 0.0000197
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 3.66e-20
Family Ribosomal protein S27a 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099908   Gene: ENSMUSG00000020460   Transcript: ENSMUST00000102844
Sequence length 156
Comment pep:known chromosome:NCBIM37:11:29445846:29447860:-1 gene:ENSMUSG00000020460 transcript:ENSMUST00000102844
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences A0A0P6CA83 P62982 P62983 Q642L7 Q6PED0
ENSMUSP00000099908 ENSMUSP00000099909 ENSMUSP00000077824 ENSMUSP00000099908 NP_001029037.1.92730 NP_001292372.1.100692 NP_001292372.1.4139 NP_077239.1.92730 NP_112375.1.100692 NP_112375.1.4139 XP_021049063.1.100879 XP_021049222.1.100879 ENSMUSP00000099908 10090.ENSMUSP00000077824 10090.ENSMUSP00000099908 10116.ENSRNOP00000005872 10116.ENSRNOP00000048664 ENSRNOP00000005872 ENSRNOP00000048664 ENSRNOP00000005872 ENSRNOP00000048664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]