SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100011 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100011
Domain Number 1 Region: 511-676
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 7.06e-72
Family A middle domain of Talin 1 0.000000032
Further Details:      
 
Domain Number 2 Region: 776-911
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.31e-53
Family I/LWEQ domain 0.000000231
Further Details:      
 
Domain Number 3 Region: 2318-2509
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.79e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 681-805
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.11e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 5 Region: 1864-1996
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.86e-46
Family VBS domain 0.000000396
Further Details:      
 
Domain Number 6 Region: 1248-1384
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.67e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 218-331
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 8 Region: 1098-1230
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.33e-26
Family VBS domain 0.027
Further Details:      
 
Domain Number 9 Region: 332-422
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 10 Region: 1434-1578
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000129
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 102-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000289
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1718-1837
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000314
Family VBS domain 0.023
Further Details:      
 
Domain Number 13 Region: 2033-2155
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000111
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000100011
Domain Number - Region: 972-1065
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000569
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1621-1681
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00494
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 2123-2250
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0576
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100011   Gene: ENSMUSG00000028465   Transcript: ENSMUST00000102947
Sequence length 2564
Comment pep:known chromosome:NCBIM37:4:43544385:43575455:-1 gene:ENSMUSG00000028465 transcript:ENSMUST00000102947
Sequence
RAQGGAQSRAAQVSPGRRAEAATMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIP
EALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTV
KTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKK
MEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYV
QARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGER
KIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECV
MRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYID
IILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGA
SGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFE
TLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAV
TTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNL
LQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSG
LQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAA
TEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMG
DAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGA
AAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQH
AASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPG
GKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVV
QNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYA
GIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPG
DPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQE
AQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQED
RAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQA
PGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNG
NLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMA
CQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTA
NLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAME
PIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPG
QLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLA
SAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLY
TAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQ
LDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLA
SQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRV
SEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHRE
GILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQ
VVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVED
EATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCR
QEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLT
LQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIE
AAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVG
AIPANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQ
LLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGG
IAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences ENSMUSP00000100011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]