SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100157 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100157
Domain Number 1 Region: 25-117
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-37
Family V set domains (antibody variable domain-like) 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100157   Gene: ENSMUSG00000076555   Transcript: ENSMUST00000103356
Sequence length 119
Comment pep:known chromosome:NCBIM37:6:69494353:69494886:-1 gene:ENSMUSG00000076555 transcript:ENSMUST00000103356
Sequence
MDFLVQIFSFLLISASVAMSRGENVLTQSPAIMSASPGEKVTMTCRASSSVSSSYLHWYQ
QKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGYPL
Download sequence
Identical sequences A0A075B5M4
ENSMUSP00000100157 ENSMUSP00000100157 ENSMUSP00000100157 10090.ENSMUSP00000100157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]