SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100600 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100600
Domain Number 1 Region: 5-449,561-614
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-75
Family GDI-like N domain 0.0000000000411
Further Details:      
 
Domain Number 2 Region: 450-560
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.8e-36
Family GDI-like 0.00000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100600   Gene: ENSMUSG00000078185   Transcript: ENSMUST00000104984
Sequence length 621
Comment pep:known chromosome:NCBIM37:1:177616619:177618484:-1 gene:ENSMUSG00000078185 transcript:ENSMUST00000104984
Sequence
MAEKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLQSWLK
DYQQNHDSEEGVTATWQDLIHETEEAISLRKKDETIQHTEVFCYASQDVEDSVQDTETLQ
RSSPLEASATPADSLDSASLPKERQSAYSTSYEVPSRHTEESDRELSLPSANVEDSLEKE
KYCGDKTDMHTVSGEDKGEHKLVVQDSIEQPKRNRITYSQMVKESRRFNIDLVSKPLYSQ
GSLIDLLIKSNVSRYAEFKNVTRILAFWEGKVEQVPCSRADVFNSKELSMVEKRMLMKFL
TFCLDYEQHSDEYQDFKQCSFSDYLKTKKLTPNLQHFILHSIAMTSESSCTTLDGLQATK
TFLQCLGRFGNTPFIFPLYGHGEIPQCFCRMCAVFGGVYCLRHKVQCLVVDKDSGRCKGI
IDAFGQRISANYFIVEDSYLPKETCSNVQYKQISRAVLITDQSILKTDSDQQISILVVPP
LEPGTTSVRVMELCSSTMTCMKDSYLVHLTCSSSKTAREDLEPVVKQLFIPEAEAEAGKD
ELRKPRLLWALYFNMRDSSGVSRSSYCGLPSNVYICSGPDWGLGSEHAVKQAETLFQEIF
PSEEFCPPPPNPEDIIFEAEG
Download sequence
Identical sequences A0A0R4J1A1
ENSMUSP00000100600 ENSMUSP00000100600 NP_067325.2.92730 10090.ENSMUSP00000100600 ENSMUSP00000100600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]