SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101012 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101012
Domain Number 1 Region: 290-572
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.37e-50
Family FCH domain 0.0093
Further Details:      
 
Domain Number 2 Region: 778-985
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000875
Further Details:      
 
Domain Number 3 Region: 707-759
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000673
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101012   Gene: ENSMUSG00000035697   Transcript: ENSMUST00000105373
Sequence length 1127
Comment pep:novel chromosome:NCBIM37:10:79479661:79494214:1 gene:ENSMUSG00000035697 transcript:ENSMUST00000105373
Sequence
MGIACNYNTMLGPRWGNRASYSPHQAEWPATRSGLNLGGRITELPRKDWTEAPGLEPPAT
SLSTVAKGTGTLKRPTSLSRHASAAGFPLSGTATWTLGRGYRSPLSAASPAELPTEGAFP
DGVEDISTLLADVARFAEGLEKLKECVLQDDLLEARRPLAHECLGEALRVMRQVISRYPL
LNTVETLTAAGTLIAKVKAFHYECNNESDKREFEKALETIAVSFSCTVSEFLLGEVDSST
LLAVPPGDPSQSMENLYGAGTEGPPHNVEECEEGCLPPEEVDMLLQRCEGGVDAALQYAK
DMARYMKDLISYLEKRTTLEMEFAKGLQKVVHNCRQSVTHEPHMPLLSIYSLALEQDLEF
GHGMVQAAGTLQTQTFMQPLTLRRLEHERRRKEIKESWHRAQRKLQEAEANLRKAKQGYK
QRCEDHDKARLQVAKAEEEQQGTGPGAGTAASKALDKRRRLEEEAKNKAEEAMATYRTCV
ADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQLMHMQTAPLPVNFQMLCES
SKLYDPGQQYASHVRQLQRGEEPDVRYDFEPYVSNNSWSPIMRTRKGSFNPGDASGPEAA
GSPPEEGGTSEAAPNKDHRGGRGHQVHKSWPISISDTEVGLDTSSGDLKKFDRTSSSGTM
SSSEELGDQEAGLVASAFDSADLNGMDPELPVAMPSGPFRHVGLSKAARTHRLRKLRTPA
KCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSQAALSTPD
GVPFIVKKCVCEIERRALHTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNV
LKLYLRQLPEPLISFRFYHELVGLAKDSLKAEAEAKAASRGRQGGSESEAATLAMVGRLR
ELMQDLPAENRATLLYLLKHLRRIVEMEQDNKMTPGNLGIVFGPTLLRPRPTDATVSLSS
LVDYPHQARVIETLIVHYGLVFEEEPEEAPGSQEGASTQCGQLESAEGIVFPLQEEAEDG
SRESHAASNDSDSELEDASDPLSSSDASALHRLSFLEQTEAGLEEGPQSHSGSEEQLEGE
DGAPGPWLCHFNTNQSNNTSRAPLPTMRLRGGQITGGTSQERQPQFV
Download sequence
Identical sequences D3Z7R7
10090.ENSMUSP00000101012 ENSMUSP00000097100 ENSMUSP00000101012 XP_006514171.1.92730 ENSMUSP00000101012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]