SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101473 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101473
Domain Number 1 Region: 298-691,772-777,808-850
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.29e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000624
Further Details:      
 
Domain Number 2 Region: 676-784
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 192-298
Classification Level Classification E-value
Superfamily Homeodomain-like 1.88e-30
Family SWIRM domain 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101473   Gene: ENSMUSG00000036940   Transcript: ENSMUST00000105847
Sequence length 873
Comment pep:novel chromosome:NCBIM37:4:136106459:136158602:-1 gene:ENSMUSG00000036940 transcript:ENSMUST00000105847
Sequence
MLSGKKAAAAAAAAAAAAAAGTEAGSGAAGGAENGSEVAAPPAGLTGPTDMATGAAGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQ
DDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQ
LWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTG
KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG
NPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFN
VLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELH
QQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDV
YLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALA
EGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQF
VPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYK
APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARG
SYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL
REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences A3KG93
XP_006539393.1.92730 10090.ENSMUSP00000101473 ENSMUSP00000101473 ENSMUSP00000101473 ENSMUSP00000101473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]