SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101522 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101522
Domain Number 1 Region: 162-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-49
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 1773-1839
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-19
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 622-717
Classification Level Classification E-value
Superfamily PDZ domain-like 4.79e-19
Family PDZ domain 0.000011
Further Details:      
 
Domain Number 4 Region: 512-589
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101522   Gene: ENSMUSG00000037541   Transcript: ENSMUST00000105902
Sequence length 1841
Comment pep:known chromosome:NCBIM37:7:151187833:151610399:1 gene:ENSMUSG00000037541 transcript:ENSMUST00000105902
Sequence
MPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATTEKPGGVKMEELQGNTLVIR
VVIQDLQQTKCIRFNPDATVWVAKQRILCTLNQGLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPMGPGVPSLEFRYKKRVYKQSNLDEKQLARLHTKTNLKKFMDHAQHRSVEKLA
KLLDRGLDPNFHDLETGETPLTLAAQLDDSMEVIKALRNGGAHLDFRSRDGMTALHKAAR
MRNQVALKTLLELGASPDYKDSYGLTPLYHTAIVGGDPYCCELLLHEHASVCCKDENGWH
EIHQACRYGHVQHLEHLLFYGADMSAQNASGNTALHICALYNQDSCARVLLFRGGNKELK
NYNSQTPFQVAIIAGNFELAEYIKNHKETDIVPFREAPAYSNRRRRPPNTLAAPRVLLRS
NSDNNLNAGAPEWAVCSAATSHRSLSPQLLQQTPSKPDGATKSLGSYTPGPRSRSPSLNR
LGGTAEDGKRTQPHWHVGSPFTPGANKDSLSTFEYPGPRRKLYSAVPGRLFVAVKPYQPQ
VDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSK
KLFRHYTVGSYDSFDAASDCIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFP
ALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLILKVVTVT
RNLDPDDTARKKAPPPPKRAPTTALTLRSKSMTAELEELDKPEEIVPASKPSRTAENVAI
ESRVATIKQRPTSRCFPAASDVNSVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKSI
DSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPR
SPTPRVYGTIKPAFNQNPVVAKVPPATRSDTVATMMREKGMFYRRELDRFSLDSEDVYSR
SPAPQAAFRTKRGQMPENPYSEVGKIASKAVYVPAKPARRKGVLVKQSNVEDSPEKTCSI
PIPTIIVKEPSTSSSGKSSQGSSMEIDPQATEPGQLRPDDSLTVSSPFAAAIAGAVRDRE
KRLEARRNSPAFLSTDLGDEDVGLGPPAPRMQASKFPEEGGFGDEDETEQPLLPTPGAAP
RELENHFLGGGEAGAQGEAGGPLSSTSKAKGPESGPAAPLKSSSPAGPENYVHPLTGRLL
DPSSPLALALSARDRAMQESQQGHKGEAPKADLNKPLYIDTKMRPSVESGFPPVTRQNTR
GPLRRQETENKYETDLGKDRRADDKKNMLINIVDTAQQKSAGLLMVHTVDVPMAGPPLEE
EEDREDGDTKPDHSPSTVPEGVPKTEGALQISAAPEPAVAPGRTIVAAGSVEEAVILPFR
IPPPPLASVDLDEDFLFTEPLPPPLEFANSFDIPDDRAASVPALADLVKQKKNDTSQPPT
LNSSQPANSTDSKKPAGISNCLPSSFLPPPESFDAVTDSGIEEVDSRSSSDHHLETTSTI
STVSSISTLSSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIVHKSNALYQDTLPEE
DTDGFVIPPPAPPPPPGSAQAGVAKVIQPRTSKLWGDVPEVKSPILSGPKANVISELNSI
LQQMNRGKSVKPGEGLELPVGAKSANLAPRSPEVMSTVSGTRSTTVTFTVRPGTSQPITL
QSRPPDYESRTSGPRRAPSPVVSPTELSKEILPTPPPPSATAASPSPTLSDVFSLPSQSP
AGDLFGLNPAGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFM
DNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
Download sequence
Identical sequences D3Z5K8
ENSMUSP00000101522 10090.ENSMUSP00000101522 ENSMUSP00000095542 ENSMUSP00000101522 XP_006508595.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]