SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101684 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101684
Domain Number 1 Region: 194-393
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-61
Family Reprolysin-like 0.0000103
Further Details:      
 
Domain Number 2 Region: 412-487
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.01e-19
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101684   Gene: ENSMUSG00000025473   Transcript: ENSMUST00000106069
Sequence length 826
Comment pep:known chromosome:NCBIM37:7:147164831:147178461:-1 gene:ENSMUSG00000025473 transcript:ENSMUST00000106069
Sequence
MLGLWLLSVLWTPAVAPGPPLPHVKQYEVVWPRRLAASRSRRALPSHWGQYPESLSYALG
TSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQEQDHCLYQGHVEGYEGSAASIS
TCAGLRGFFRVGSTVHLIEPLDADEEGQHAMYQAKHLQQKAGTCGVKDTNLNDLGPRALE
IYRAQPRNWLIPRETRYVELYVVADSQEFQKLGSREAVRQRVLEVVNHVDKLYQELSFRV
VLVGLEIWNKDKFYISRYANVTLENFLSWREQNLQGQHPHDNVQLITGVDFIGSTVGLAK
VSALCSRHSGAVNQDHSKNSIGVASTMAHELGHNLGMSHDEDIPGCYCPEPREGGGCIMT
ESIGSKFPRIFSRCSKIDLESFVTKPQTGCLTNVPDVNRFVGGPVCGNLFVEHGEQCDCG
TPQDCQNPCCNATTCQLVKGAECASGTCCHECKVKPAGEVCRLSKDKCDLEEFCDGRKPT
CPEDAFQQNGTPCPGGYCFDGSCPTLAQQCRDLWGPGARVAADSCYTFSIPPGCNGRMYS
GRINRCGALYCEGGQKPLERSFCTFSSNHGVCHALGTGSNIDTFELVLQGTKCEEGKVCM
DGSCQDLRVYRSENCSAKCNNHGVCNHKRECHCHKGWAPPNCVQRLADVSDEQAASTSLP
VSVVVVLVILVAAMVIVAGIVIYRKAPRQIQRRSVAPKPISGLSNPLFYTRDSSLPAKNR
PPDPSETVSTNQPPRPIVKPKRPPPAPPGAVSSSPLPVPVYAPKIPNQFRPDPPTKPLPE
LKPKQVKPTFAPPTPPVKPGTGGTVPGATQGAGEPKVALKVPIQKR
Download sequence
Identical sequences Q05910 Q3U1J7
ENSMUSP00000026546 NP_031429.1.92730 ENSMUSP00000101684 ENSMUSP00000101684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]