SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102236 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102236
Domain Number 1 Region: 650-760,789-853
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000703
Family Mannose 6-phosphate receptor domain 0.0079
Further Details:      
 
Domain Number 2 Region: 268-338,375-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000654
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102236
Domain Number - Region: 570-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000104
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number - Region: 49-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0256
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102236   Gene: ENSMUSG00000040412   Transcript: ENSMUST00000106625
Sequence length 1009
Comment pep:known chromosome:NCBIM37:3:108258612:108339431:-1 gene:ENSMUSG00000040412 transcript:ENSMUST00000106625
Sequence
MAEPGHNPHPSARDGGKTERRTPRLLWLLLWAGTTFQVTLGTGPELHACKESEYHFEYTA
CDSTGSRWRVAVPHSPGLCTSLPDPVKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGT
GIRFDEWDELPHGFASLSANLEVDDSISESTENCTSSKWVPRGDYIASNTDECTATLMYA
VNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPSADDSRWMKTTEKGWVELNRGNNVLYW
RTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPGTYAAKQGSPFCKLCPANYYSNKG
ETSCHPCDADKYSEKGSSTCKVRPACTDKDYFYTHTACDAQGETQLMYKWAIPKICGEDL
EGAVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSYSNGSDCTHCPAGTEPAVGFEYK
WWNTLPSNMETTVLSGINFEYKGLTGWEVAGDHIYTAVGASDNDFMILTLVVPGFRPPQS
VVADTENKEVARITFVFETICSVNCELYFMVGMNSRTNTPVETWKGTKGKQSYTYTIEEN
ATVSFTWAFQRTTLHETGRKYTNDVAKIYSINVTNVMGGVASYCRPCALEASDLGSSCTS
CPAGHYINRDSGTCHLCPSNTILKAHQPYGAQACVPCGPGTKNNKIHSLCYNDCTFSRNT
PSRIFNYNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQGKKMAVCTDNVTDLRIP
DGEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVGVSTDMTLEGIVSPVEL
FHPETSGIPDIVFFFRSNDVTQSCSSGRSTTIRLRCNPMKAAPGTLRLPSMCSDGTCDGC
NFHFLWESVAACPLCSASDYHTFVSSCVAGIQKTTYMWREPKLCSGGISLPEQRVTICKT
IDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADSCAIM
EGEDVEDDFIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGPDMDM
Download sequence
Identical sequences A2AFS3
10090.ENSMUSP00000102236 ENSMUSP00000102236 ENSMUSP00000040128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]