SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102441 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102441
Domain Number 1 Region: 300-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-36
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily RING/U-box 4.52e-25
Family RING finger domain, C3HC4 0.0067
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.18e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102441
Domain Number - Region: 120-228
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000209
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102441   Gene: ENSMUSG00000078616   Transcript: ENSMUST00000106828
Sequence length 513
Comment pep:novel chromosome:NCBIM37:7:111530579:111539100:-1 gene:ENSMUSG00000078616 transcript:ENSMUST00000106828
Sequence
MMASSALAMAKEEVTCPICLELLKEPVSTDCGHSFCQTCIILNYVSNRRMDGVGSCPVCR
VGYLFENLRPNQNMINIVKRIKELKSIPEEKEKVFYCAQHGEKLKLFCKEDRMAICWVCE
RSQKHRGHQTALIEEVDQEYKEKLQAALKKLMENEKRCDKWQDDLQQQRADWENQIQRDV
EYVQMELKGLRDLLDSKENEGLQELKKEKEEVMEKLEESENELREQTELVRDLISDVGHQ
LALSTMEMLQGMNSVLTRIQVLRLKQPQTIPPKRRRTYQVQDQVQDLNVMLQAIQGLMYV
RRYWVHVTLYANNHAVIAINKEKRQIQHTSYYKRNLQISKTYNLGVLGYPAICSGKHYWE
VDVSRKKTWILGLNDGLCVQPQLHSISEMGFKVKYNSSVKQCGNYQHKYGYWVIGMKNWS
VYNASDECSVTHNSSVLALSLSGPPSRVGVFLDREACTLSFYDVSNFGALIYRFYEPFFP
HTVYPYFNPMECSEPMTVCGPSSSISVETQSKE
Download sequence
Identical sequences D3YVI9
ENSMUSP00000102441 10090.ENSMUSP00000102441 ENSMUSP00000102441 ENSMUSP00000102441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]