SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102546 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102546
Domain Number 1 Region: 792-968
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-47
Family Chaperone J-domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 118-274
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.42e-26
Family Dual specificity phosphatase-like 0.00029
Further Details:      
 
Domain Number 3 Region: 282-420
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.15e-25
Family PLC-like (P variant) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102546   Gene: ENSMUSG00000028528   Transcript: ENSMUST00000106933
Sequence length 968
Comment pep:known chromosome:NCBIM37:4:101223199:101315387:1 gene:ENSMUSG00000028528 transcript:ENSMUST00000106933
Sequence
MSLLGSYRKKTSSDGYESLQLVDSHGDSSARGAAAGTQRATAGAVRSPARQPPHRASTTD
SSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLD
FTYVTSRIIVMSFPVDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRV
SECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLY
STPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKAITVSPVPFFN
KQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVIVSMYHLRS
TIGSRLQAKVTNTQIFQLQFHSGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDIEV
QPQDKVIDLTPPWEHYCTKDVNPSILFSSQQEHQDTLALGGQAPADLPPDHPRNLGQGGF
FASLCWQDQKSEKSRCEEDHAALVNQESEQSDDELLTLSSPHGNAEGDKPHGAKKPGKKQ
QEPAAPPPPEEVDLLGLEGSDVSTNFSSLAAPPSNSELLSDLFGGVGATGPAQAGQAGVE
DVFHPSGPVSAQSTPRRTATSASASPTLRVGEGATFDPFGAPAKPPGQDLLGSFLNTSSA
SSDPFLQPTRSPSPTVHASSTPAVNIQPDIAGGWDWHTKPGGFGMGSKSAATSPTGSSHG
TPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQP
AGYNWQQTQSKPQSSMPHSSPQNRPNYNVSFSAMPAGQSERGKGSTNLEGKQKAADFEDL
LSSQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLW
AGETKWKPVGMADLVTPEQVKKVYRRAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE
NQGQKPLY
Download sequence
Identical sequences ENSMUSP00000102546 NP_001158055.1.92730 ENSMUSP00000102546 ENSMUSP00000102546 10090.ENSMUSP00000102546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]