SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103261 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103261
Domain Number 1 Region: 2180-2480
Classification Level Classification E-value
Superfamily BEACH domain 6.15e-130
Family BEACH domain 0.0000000000156
Further Details:      
 
Domain Number 2 Region: 2546-2839
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-33
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 3 Region: 186-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-30
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 4 Region: 2069-2175
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-29
Family PreBEACH PH-like domain 0.00000234
Further Details:      
 
Domain Number 5 Region: 467-570,649-943
Classification Level Classification E-value
Superfamily ARM repeat 5.35e-21
Family Mo25 protein 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103261   Gene: ENSMUSG00000028080   Transcript: ENSMUST00000107635
Sequence length 2854
Comment pep:known chromosome:NCBIM37:3:86028612:86586615:1 gene:ENSMUSG00000028080 transcript:ENSMUST00000107635
Sequence
MASEDNRAPSRPPTGDDGGGGGKEETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEV
SNRDIVETVFNLLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTAILKK
SIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDK
GQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFHTWLRMD
PVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWY
MVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQ
MTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFT
YNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLF
AQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHV
SRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIG
TVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPNQKEILSLRAFLLM
FIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNG
LRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLIT
MTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIATLLRNSPQCPESMEVRR
AFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYH
AVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRKGDEETGPCSSSLVPEGTG
ATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSIDSASNTELQTHDMSSDEKK
VERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINSNSLEPGKDTVTISEVSASIS
SPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEEAGLPTELQGEGLSVAASEGRE
EPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVATAGSLATSSEVPVPQATVQSDS
HEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQKITKLDVSSVASDTERFELKASTS
TEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDSRSTMFRIPEFKWSQMHQRLLTDLL
FSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAAT
SATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQC
LRLVCAVAVRNCLECQQHSQLKARGDTAKSSKTIHSLIPMGKSAAKSPVDIVTGGISPVR
DLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQ
SLKETSSDNGNASLPDAENTPAEFSSLTLSSVEESLEGTSCTRRRDSGLGEETASGLGSG
LSVASPAAPLGVSAGPDAISEVLCTLSLEVNKSQETRIDGGNELDRKVTPSVPVSKNVNV
KDILRSLVNMPADGVTVDPALLPPACLGALGDLSVDPPMQFRSFDRSVIIATKKSSVLPS
ALTTSAPSSAVSVVSSVDPTHASDTGGESPGSRSPNAKLPSVAAVGSVPQDPAAHMSITE
RLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLC
SQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFE
SLCAQYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPRE
FWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHAADEDILAKGKQSIKSQALGNQN
SENEALLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVD
EEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPD
PATVKKVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFL
NTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFE
SWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRN
SQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRL
ALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEA
QIRSFGQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQP
GLAMPAVITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIACGTGTHRRQVTDL
LDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSES
YIGGNCYILSGSRDATLLLWYWNGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAEL
GLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVN
GKLQATVETDDHIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMAL
SFDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY
Download sequence
Identical sequences E9Q3Y4
ENSMUSP00000103261 NP_109620.2.92730 10090.ENSMUSP00000103261 ENSMUSP00000103261 ENSMUSP00000103261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]