SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103408 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103408
Domain Number 1 Region: 960-1025
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000893
Family SAM (sterile alpha motif) domain 0.069
Further Details:      
 
Domain Number 2 Region: 831-907
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000103
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Domain Number 3 Region: 1033-1107
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000018
Family SAM (sterile alpha motif) domain 0.078
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000103408
Domain Number - Region: 81-103,236-411
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00889
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.026
Further Details:      
 
Domain Number - Region: 400-441
Classification Level Classification E-value
Superfamily BAS1536-like 0.0536
Family BAS1536-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103408   Gene: ENSMUSG00000003863   Transcript: ENSMUST00000107779
Sequence length 1194
Comment pep:novel chromosome:NCBIM37:7:52594496:52622084:-1 gene:ENSMUSG00000003863 transcript:ENSMUST00000107779
Sequence
MMCEVMPTISEDGRRGSALGPDEAGGELERLMVTMLTERERLLETLREAQDGLATAQLRL
RELGHEKDSLQRQLSIALPQEFAALTKELNLCREQLLEREEEIAELKAERNNTRLLLEHL
ECLVSRHERSLRMTVVKRQAQSPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRMALER
VAVLEEELELSNQEALNLRDQLSRRRSGLEEPGKDGDGQTLANGLGPVGESNRRTAELEE
ALERQRAEVCQLRERLAVLCRQMSQLEEELGTAHRELGKAEEANSKLQRDLKEALAQRED
MEERITTLEKRYLSAQREATSLHDANDKLENELASKESLYRQSEEKSRQLAEWLDDAKQK
LQQTLQKAETLPEIEAQLAQRVAALNKAEERHGNFEERLRQLEAQLEEKNQELQRARQRE
KMNDDHNKRLSETVDKLLSESNERLQLHLKERMGALEEKNSLSEEIANMKKLQDELLLNK
EQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGAPLDPYGAGSGRA
GKRGRWSGAKDESSKDWDRSAPAGSIPPPFPGELDGSDEEEAEGMFGAELLSPSGQADVQ
TLAIMLQEQLEAINKEIKLIQEEKETTEQRAEELESRVSSSGLDSLGRYRSSCSLPPSLT
TSTLASPSPPSSGHSTPRLAPPSPAREGTDKTNHVSKEEAGVPRGEGPAVPGDTPPPTPR
SARLERMAQALALQAGSPEDGAPPRGSESTPDSLHKAPKRKSIKSSIGRLFGKKEKGRMG
PPGRESVSLAGTPSDETLATDPLGLAKLTGPGDKDRRNKRKHELLEEACRQGLPFAAWDG
PTVVSWLELWVGMPAWYVAACRANVKSGAIMANLSDTEIQREIGISNPLHRLKLRLAIQE
MVSLTSPSAPASSRTPTGNVWMTHEEMESLTAATKPETKEISWEQILAYGDMNHEWVGND
WLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYD
RKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDY
SDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLR
GVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC
Download sequence
Identical sequences P60469
ENSMUSP00000003961 ENSMUSP00000103408 10090.ENSMUSP00000103408 NP_084017.2.92730 XP_006541336.1.92730 XP_011249214.1.92730 ENSMUSP00000103408 NYSGXRC-13145a ENSMUSP00000003961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]