SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103571 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103571
Domain Number 1 Region: 175-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 658-754
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-20
Family PDZ domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 540-615
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 2100-2163
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000529
Family SAM (sterile alpha motif) domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103571   Gene: ENSMUSG00000038738   Transcript: ENSMUST00000107938
Sequence length 2167
Comment pep:novel chromosome:NCBIM37:7:51565623:51613721:1 gene:ENSMUSG00000038738 transcript:ENSMUST00000107938
Sequence
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPQGTRGRGSGAPGNLASTRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGTPGPTSGSQGQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIDSGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKASQQAKRLPPP
AISLRSKSMTSELEEMVSPWKKKIEYEQQPAAVPSMEKKRTVYQMALNKLDEILAAAQQT
ISASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYDRPSFLPPGPGLMLRQKSIG
AAEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGG
PFNPGSGGPLPASSPSSFDGPSPPDPRSGGREKSLYHSGALPPAHHHPPHHHHHHAPPPQ
PHHHHAHPPHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTSGAPSPSHHSSSGG
SSGPAQAPALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGSLPPASSPT
SPALPRSEPPPAGPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPDGAGGGGS
SPSPAPATSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTL
FLSTDAGDEDGGDSGLGPGAPPGPRLRHSKSIDEGMFSAEPYLRLESGGSSGGYGAYAAG
SRAYGGSGSSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGVTPQP
PPRPPSPRYDAPPPTLHHHSPHSPHSPHARHEPVLRLWGDPARRELGYRAGLGSQEKALT
ASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPPTPHPGVSKAWRTAAPEEPERLPLHVRF
LENCQARPPPAGTRGSSTEDGPGVPPPSPRRVLPTSPTSPRGNEENGLPLLVLPPPAPSV
DVDDGEFLFAEPLPPPLEFSNSFEKPESPLTPGPPHPLPDPPSPATPLPAAPPPAVAAAP
PTLDSTASSLTSYDSEVATLTQGAPAAPGDPPAPGPPAPAAPAPPAPQPGPDPPPGTDSG
IEEVDSRSSSDHPLETISSASTLSSLSAEGGGNTGGVAGGGAGVASGTELLDTYVAYLDG
QAFGGSGTPGPPYPPQLMTPSKLRGRALGTSGNLRPGPSGGLRDPVTPTSPTVSVTGAGT
DGLLALSACSGPSTAGVAGGPVAVEPEVPPVPLPTASSLPRKLLPWEEGPGPPPPPLPGP
LSQPQASALATVKASIISELSSKLQQFGGASTAGGALPWARGGSGGSTDSHHGGASYIPE
RTSSLQRQRLSEDSQTSLLSKPSSSIFQNWPKPPLPPLPTGSGVSSSTAAAPGATSPSAS
SASASTRHLQGVEFEMRPPLLRRAPSPSLLPASDHKVSPAPRPSSLPILPSGPLYPGLFD
IRSSPTGGAGGSADPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKP
LGFWTKFDVADWLEWLGLSEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRA
LKFFLER
Download sequence
Identical sequences D3YZU1
10090.ENSMUSP00000103571 ENSMUSP00000103571 ENSMUSP00000103567 NP_001029287.1.92730 XP_006540927.1.92730 ENSMUSP00000103571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]