SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103690 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103690
Domain Number 1 Region: 201-542
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.91e-112
Family Motor proteins 0.0000000408
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000266
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103690   Gene: ENSMUSG00000028438   Transcript: ENSMUST00000108055
Sequence length 1356
Comment pep:known chromosome:NCBIM37:4:41337778:41411873:-1 gene:ENSMUSG00000028438 transcript:ENSMUST00000108055
Sequence
MASWLYECLCEAELAQYYPHFTALGLQKIDELAKVTMKDYSRLGVHDMNDRKRLFQLIKI
IKIMQEEDKALGIPEHPLQASSLYTKPREFRSGPRRQLHFDSPSASKDKMANNETGSLSN
FSVDEQKSTYLKVLEHMLPDDSQCQTKIRAPDASAADASMQTETNAPLFSSNYFSPQLGN
CDIPVIQRVSHVSGYNYGIPHSCVRQITSENPWTEMEKIRVCVRKRPLGVREVRRGEVNV
ITVEDKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACSNQDVYLKTAHPLIQHIFNGG
SATCFAYGQTGAGKTYTMIGTHQNPGLYALAAKDIFRQLKVSQSRRNLFVWISFYEIYCG
QLYDLLNRRKRLFAREDSKHVVQIAGLRELQVDSVELLLQVILKGSKERSTGATGVNADS
SRSHAIIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLLALKEC
IRALDQEHTHTPFRQSKLTQVLKDSFIGNAKTCMIANISPSHIATEHTLNTLRYADRVKE
LKKGVKCCASATSQNQTSANASPKRIQSSPVTLPGDKCSPKKVKLGLQQSLTVAPGPTKV
KAHPLASHVPNVPFTSGPKTPGKKSSSRGSPTPEWDMKASPRKGTTRSGHSIKKGAESAP
LCSEKSQIGSKIAVGWEGRASDPGEGLLRVRLPTRGKKVQPVQPVQKQLLSRPRLLANSH
HLEATQDSKVGTPAGLAPEAWTNPILQQKEREEHLRFYHQQFQQPPLLKQKLNYQPLQRL
LCQHRPSEGRLQSETGFPLHSNPENRDGAQAEDLDDSDFSEDSFSHGSSQPAMKQGSTAL
ERSGSSFFLHQDREHSPEEQAAERQQCLLFSSETDGSKKRPADSWVYSRDPIISHRRGAL
SQSHSPSMVCPDWSKEEDSASSGPSPKDNRAQKPSSSQVDFVHHQKPGEAQVSDIRLEAF
TSEVPEQAEGSLSSPSPENGLSFPLSHVAVSGSPDQRDRVCTPLREVSENRVTHTPGRVN
SSTPFQEDSGEQIQMCSANASGLMAPLTMSLLETPCHEDLSSLEQIAQDGAGYGFMAEIV
GGPAAGHTVPSYDQEAALPVSSATECLWLSSSPPDNRPSGDLPALSPSPIHQHSPDKLPG
REAYQTRRPILLPENHMGSKLYDDRAEETELGGSLTFPRKPSSNIHAGVPYSTPFLTSCT
GSSNGVGRPWAQERKHPTGVSCQELVSSTDSNKPHYNEDIAWLRHRPISRCLDSDSPVVP
SCSSKALRTYCPLTPEQAQQVIIRAHKEQLDEMAELDLKEETLMTQMDSNDFEDFVTQLD
EIMALKSRCIQSLRSQLQLYLTSHRPAAAPERTVVS
Download sequence
Identical sequences Q6NWW5
ENSMUSP00000103690 10090.ENSMUSP00000103690 ENSMUSP00000030148 NP_077203.2.92730 XP_006537612.1.92730 XP_011248205.1.92730 ENSMUSP00000103690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]