SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103788 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103788
Domain Number 1 Region: 5-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-61
Family Dual specificity phosphatase-like 0.00000000421
Further Details:      
 
Domain Number 2 Region: 248-461
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.6e-39
Family mRNA capping enzyme 0.00025
Further Details:      
 
Domain Number 3 Region: 463-575
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103788   Gene: ENSMUSG00000028274   Transcript: ENSMUST00000108153
Sequence length 597
Comment pep:known chromosome:NCBIM37:4:33397286:33589589:1 gene:ENSMUSG00000028274 transcript:ENSMUST00000108153
Sequence
MAYNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERSPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPVLPDWCFEDEDEEDEDEDGKKDSEPGSSASFSKRRKERLKLGAIFLEGITVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYL
IYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINI
SRKLLEGNFAKEVSHEMDGLIFQPIGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEG
LLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRIDKSFPNAYN
TAMAVCNSISNPVTKEMLFEFIDRCAAAAQGQKRKYPLDPDTELMPPPPPKRLHRPT
Download sequence
Identical sequences O55236 Q3UA94
ENSMUSP00000103788 NP_036014.1.92730 ENSMUSP00000103788 ENSMUSP00000029942 10090.ENSMUSP00000103788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]